DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and mmgt1

DIOPT Version :9

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_991162.1 Gene:mmgt1 / 402891 ZFINID:ZDB-GENE-040801-65 Length:130 Species:Danio rerio


Alignment Length:109 Identity:58/109 - (53%)
Similarity:78/109 - (71%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIV 65
            |.|..:..::.|..|| |||||||||.||:|:||||:|..:||:||:|||::|.||..|.|:.|.
Zfish     1 MASSFWKGVVGIGLFA-LAHAAFSAAQHRSYMRLTEKENETLPIDIVLQTLLSFVITCYGIVHIS 64

  Fly    66 GNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRALNPGYTPPE 109
            |.||::.|:.:::.||:|||.|.||||.||||||.|   :..||
Zfish    65 GEFKDMDASSELKNKTFDTLRNHPSFYLFNHRGRVL---FRTPE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:402060 16/29 (55%)
mmgt1NP_991162.1 MMgT 26..>61 CDD:313496 19/34 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8827
eggNOG 1 0.900 - - E1_KOG3918
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15570
Inparanoid 1 1.050 112 1.000 Inparanoid score I4842
OMA 1 1.010 - - QHG55497
OrthoDB 1 1.010 - - D1558871at2759
OrthoFinder 1 1.000 - - FOG0004821
OrthoInspector 1 1.000 - - oto41510
orthoMCL 1 0.900 - - OOG6_105066
Panther 1 1.100 - - LDO PTHR21181
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5472
SonicParanoid 1 1.000 - - X3960
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.870

Return to query results.
Submit another query.