DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and sicily

DIOPT Version :9

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001285142.1 Gene:sicily / 32151 FlyBaseID:FBgn0030352 Length:334 Species:Drosophila melanogaster


Alignment Length:104 Identity:23/104 - (22%)
Similarity:39/104 - (37%) Gaps:40/104 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKLFNKL----LLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNI 61
            :||:..||:    |:.|......||..|......|   |||.::||.| ::|:            
  Fly   143 VGSRKLNKVYLRRLVTARERPPTHAFESIRELEEY---TEQTFSSLLL-LLLE------------ 191

  Fly    62 IEIVGNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRA 100
               ||..:::.|.                 ::.:|.|:|
  Fly   192 ---VGGVRDLNAD-----------------HAASHLGKA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:402060 7/29 (24%)
sicilyNP_001285142.1 SQS_PSY 60..312 CDD:278896 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21181
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.