DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and Mmgt2

DIOPT Version :9

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001013989.2 Gene:Mmgt2 / 303211 RGDID:1311260 Length:124 Species:Rattus norvegicus


Alignment Length:94 Identity:42/94 - (44%)
Similarity:66/94 - (70%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIVGNFKEIR 72
            |:|:..|.::|||||||||.||:::||.|.::..||.||:|||:::..:..|.::...|:|::..
  Rat     7 KVLVGVGLSALAHAAFSAAQHRSHMRLAEMKYEPLPTDIVLQTLLAFALTCYGVVHTAGDFRDRD 71

  Fly    73 ATVDMQQKTWDTLGNFPSFYSFNHRGRAL 101
            ||.:::..|:|||.|.||||.|.|.|.:|
  Rat    72 ATSELKNVTFDTLRNRPSFYVFQHSGSSL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:402060 11/29 (38%)
Mmgt2NP_001013989.2 MMgT 29..90 CDD:402060 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8474
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4756
OMA 1 1.010 - - QHG55497
OrthoDB 1 1.010 - - D1558871at2759
OrthoFinder 1 1.000 - - FOG0004821
OrthoInspector 1 1.000 - - otm45624
orthoMCL 1 0.900 - - OOG6_105066
Panther 1 1.100 - - O PTHR21181
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3960
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.