DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and Mmgt1

DIOPT Version :9

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001100440.1 Gene:Mmgt1 / 302864 RGDID:1566339 Length:131 Species:Rattus norvegicus


Alignment Length:94 Identity:53/94 - (56%)
Similarity:71/94 - (75%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIVGNFKEIR 72
            |.|:..|..:|||||||||.||:|:||||:|..|||:||:|||:::..:..|.|:.|.|.||::.
  Rat     7 KGLVGVGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMD 71

  Fly    73 ATVDMQQKTWDTLGNFPSFYSFNHRGRAL 101
            ||.:::.||:|||.|.||||.||||||.|
  Rat    72 ATSELKNKTFDTLRNHPSFYVFNHRGRVL 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:402060 14/29 (48%)
Mmgt1NP_001100440.1 MMgT 29..>61 CDD:402060 15/31 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8474
eggNOG 1 0.900 - - E1_KOG3918
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H15570
Inparanoid 1 1.050 113 1.000 Inparanoid score I4756
OMA 1 1.010 - - QHG55497
OrthoDB 1 1.010 - - D1558871at2759
OrthoFinder 1 1.000 - - FOG0004821
OrthoInspector 1 1.000 - - otm45624
orthoMCL 1 0.900 - - OOG6_105066
Panther 1 1.100 - - LDO PTHR21181
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3960
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.