DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EMC5 and emc-5

DIOPT Version :9

Sequence 1:NP_609926.1 Gene:EMC5 / 35159 FlyBaseID:FBgn0032732 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001367261.1 Gene:emc-5 / 13187162 WormBaseID:WBGene00195248 Length:144 Species:Caenorhabditis elegans


Alignment Length:105 Identity:42/105 - (40%)
Similarity:64/105 - (60%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKLFNKLLLIAGFASLAHAAFSAAHHRTYLRLTEQEWNSLPLDIILQTVISLVIVIYNIIEIV 65
            |.|.:: :|:.|....||.|.|:|||.||.|||||||.:.:||.|::.||||||:.:||....:.
 Worm     1 MASTIY-RLITIVSLLSLLHCAYSAAQHRFYLRLTEQPFINLPSDVVAQTVISLIALIYGTSFLA 64

  Fly    66 GNFKEIRATVDMQQKTWDTLGNFPSFYSFNHRGRALNPGY 105
            ..|..|:.. ....::.|...|.|||.:|::|.:|::|.:
 Worm    65 NPFLFIKKD-QHHDRSCDEALNCPSFITFDNRAKAMSPEF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EMC5NP_609926.1 MMgT <32..>62 CDD:402060 17/29 (59%)
emc-5NP_001367261.1 MMgT 10..>75 CDD:402060 30/65 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166796
Domainoid 1 1.000 59 1.000 Domainoid score I7087
eggNOG 1 0.900 - - E1_KOG3918
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3849
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55497
OrthoDB 1 1.010 - - D1558871at2759
OrthoFinder 1 1.000 - - FOG0004821
OrthoInspector 1 1.000 - - oto17994
orthoMCL 1 0.900 - - OOG6_105066
Panther 1 1.100 - - LDO PTHR21181
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5472
SonicParanoid 1 1.000 - - X3960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.