DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and CAM6

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_850860.1 Gene:CAM6 / 832245 AraportID:AT5G21274 Length:149 Species:Arabidopsis thaliana


Alignment Length:140 Identity:46/140 - (32%)
Similarity:71/140 - (50%) Gaps:17/140 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EFSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFRE 129
            :.:.:||.::::.|:.:|...||.:..:||..:|..||...|...|:.||.|||.|.:|.|.|.|
plant     4 QLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68

  Fly   130 FL-LIFRKAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTN---KFHDEIRA 190
            || |:.||.:  :.||:..|.:..|:  .|.:|.|      |..|...:.:.||   |..||   
plant    69 FLNLMARKMK--DTDSEEELKEAFRV--FDKDQNG------FISAAELRHVMTNLGEKLSDE--- 120

  Fly   191 EQEERRREEE 200
            |.:|..||.:
plant   121 EVDEMIREAD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 21/57 (37%)
CAM6NP_850860.1 PTZ00184 1..149 CDD:185504 46/140 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.