DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and EFHD1

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_079478.1 Gene:EFHD1 / 80303 HGNCID:29556 Length:239 Species:Homo sapiens


Alignment Length:211 Identity:118/211 - (55%)
Similarity:144/211 - (68%) Gaps:5/211 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASSASNKDSVDSPS-STTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQ 70
            |.:...|...:.|: :.|.:..:||:..|:||.:|.|    |....|..:|.|.||:||||||..
Human    31 APAPEPKPEPEPPARAPTASADAELSAQLSRRLDINE----GAARPRRCRVFNPYTEFPEFSRRL 91

  Fly    71 IKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFR 135
            |||.:..|..||..||||:||.|||.|||||||||||||||.||.|||||.|||:|||||||||.
Human    92 IKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFH 156

  Fly   136 KAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEE 200
            ||.||||..||||..||:|:|:||...||.|||||||||::.....:||..|::|||:||:||||
Human   157 KAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEE 221

  Fly   201 ERAQRRQQFQQRAAIF 216
            ||..|:..||:..|.|
Human   222 ERRLRQAAFQKLKANF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 42/57 (74%)
EFHD1NP_079478.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 4/21 (19%)
EFh 94..152 CDD:238008 42/57 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147043
Domainoid 1 1.000 92 1.000 Domainoid score I7650
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3622
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52325
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - otm41399
orthoMCL 1 0.900 - - OOG6_105725
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.