DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and EFHD2

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_077305.2 Gene:EFHD2 / 79180 HGNCID:28670 Length:240 Species:Homo sapiens


Alignment Length:212 Identity:112/212 - (52%)
Similarity:146/212 - (68%) Gaps:2/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NASSASNKDSVDSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQ 70
            |.::|:...:.|..:....:...||:..|.||.::  :|..|.....:.:|.|.||:|.||||.|
Human    31 NGAAAAAAGAPDEAAEALGSADCELSAKLLRRADL--NQGIGEPQSPSRRVFNPYTEFKEFSRKQ 93

  Fly    71 IKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFR 135
            |||.:|.|..||..||||:||.|||.|||||||||||||||.||.|||||.|.|:||||||||||
Human    94 IKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFR 158

  Fly   136 KAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEE 200
            ||.||||..||||..||||:|:||...||.|||:|||||::....:::|.:||:||||||:::.|
Human   159 KAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAE 223

  Fly   201 ERAQRRQQFQQRAAIFQ 217
            |..||:..|::..:.|:
Human   224 EMKQRKAAFKELQSTFK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 42/57 (74%)
EFHD2NP_077305.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..38 2/6 (33%)
EFh 96..154 CDD:238008 42/57 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147041
Domainoid 1 1.000 90 1.000 Domainoid score I7787
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32580
Inparanoid 1 1.050 215 1.000 Inparanoid score I3622
Isobase 1 0.950 - 0 Normalized mean entropy S3918
OMA 1 1.010 - - QHG52325
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - otm41399
orthoMCL 1 0.900 - - OOG6_105725
Panther 1 1.100 - - LDO PTHR13025
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10220
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.