DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and Efhd1

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001102780.1 Gene:Efhd1 / 501181 RGDID:1559565 Length:240 Species:Rattus norvegicus


Alignment Length:199 Identity:112/199 - (56%)
Similarity:140/199 - (70%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTYD 82
            :|:.|.:.| |||...|:.|..|   .:..:..||: ||.|.||:||||||..:||.::.|.|||
  Rat    45 APAPTVSAD-SELNLKLSSRLNI---HQGAVRSRRS-KVFNPYTEFPEFSRRLLKDLERMFKTYD 104

  Fly    83 TARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDSG 147
            ..:|||:||.|||.|||||||||||||||.||.|||||.|||:|||||||||.||.||||..|||
  Rat   105 AGKDGFIDLMELKLMMEKLGAPQTHLGLKNMIQEVDEDFDGKLSFREFLLIFHKAAAGELQEDSG 169

  Fly   148 LNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQQFQQR 212
            |..||:.:|::|...||.|||||||||.:....::||..|::|||:||:||||.|..|:..|::.
  Rat   170 LLALAKFSEINVALEGVRGAKNFFEAKAQALACSSKFEAELKAEQDERKREEEARRLRQAAFREL 234

  Fly   213 AAIF 216
            .|.|
  Rat   235 KAAF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 42/57 (74%)
Efhd1NP_001102780.1 EFh 95..153 CDD:238008 42/57 (74%)
EF-hand_7 96..153 CDD:290234 41/56 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340709
Domainoid 1 1.000 96 1.000 Domainoid score I7152
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3533
OMA 1 1.010 - - QHG52325
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - otm45516
orthoMCL 1 0.900 - - OOG6_105725
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.