DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and efhd2

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001011261.1 Gene:efhd2 / 496711 XenbaseID:XB-GENE-954641 Length:202 Species:Xenopus tropicalis


Alignment Length:201 Identity:112/201 - (55%)
Similarity:137/201 - (68%) Gaps:10/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TDSSELTHILNRRQEIMESQEAGIEVRRT--------YKVVNVYTDFPEFSRNQIKDYQKTFNTY 81
            || .||...||||.. ||.........:|        .:|.|.||:|.||||.||||.:|.|..:
 Frog     3 TD-DELASRLNRRLR-MEDDGGDTTPEQTRRREQSPCMRVFNPYTEFKEFSRKQIKDMEKMFRQF 65

  Fly    82 DTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDS 146
            |...|||:||.|||.|||||||||||||||.||.|||||.|||:||||||||||||.||||:.||
 Frog    66 DAGHDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDGKLSFREFLLIFRKAAAGELEEDS 130

  Fly   147 GLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQQFQQ 211
            ||:.||||:|:||...||.|||.|||||::.....::|..||:|||||::|:.||:.||:..|::
 Frog   131 GLHALARLSEIDVSIEGVKGAKCFFEAKVQAINHGSRFEQEIKAEQEEKKRQAEEKEQRKAAFKE 195

  Fly   212 RAAIFQ 217
            ..:.|:
 Frog   196 LQSAFK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 41/57 (72%)
efhd2NP_001011261.1 EFh 57..115 CDD:238008 41/57 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7223
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32580
Inparanoid 1 1.050 220 1.000 Inparanoid score I3460
OMA 1 1.010 - - QHG52325
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - otm48603
Panther 1 1.100 - - LDO PTHR13025
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.