DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and efhd1

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001292523.1 Gene:efhd1 / 335521 ZFINID:ZDB-GENE-030131-7461 Length:227 Species:Danio rerio


Alignment Length:217 Identity:115/217 - (52%)
Similarity:147/217 - (67%) Gaps:6/217 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVSSNASSASNKDSVDSPSSTTNTD-SSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFP 64
            :...:|..:...:..| .|::|.:.| :||||..||||.:|.:    |....:..||.|.||:|.
Zfish    14 LDADTNPGTQDEETPV-KPATTMSDDTTSELTEKLNRRLDIHD----GTAKPKQMKVFNPYTEFK 73

  Fly    65 EFSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFRE 129
            ||||.||||.:..|..:|:.:|||:||.|||.|||||||||||||||.||.|||||.|||:|:||
Zfish    74 EFSRKQIKDMETMFKRFDSGKDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDYDGKLSYRE 138

  Fly   130 FLLIFRKAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEE 194
            ||||||:|.||||..:|||..||||:|:||...||.||::|||||.:.....:||..|:|.||||
Zfish   139 FLLIFRRAAAGELQEESGLMALARLSEIDVSTEGVLGARDFFEAKAQALSVRSKFEAELREEQEE 203

  Fly   195 RRREEEERAQRRQQFQQRAAIF 216
            |:|.|.||.|||..|::..:.|
Zfish   204 RKRLELERKQRRAAFKELQSTF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 39/57 (68%)
efhd1NP_001292523.1 EF-hand_7 83..140 CDD:290234 38/56 (68%)
EFh 86..140 CDD:238008 38/53 (72%)
EF-hand_7 119..182 CDD:290234 42/62 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580522
Domainoid 1 1.000 94 1.000 Domainoid score I7431
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3596
OMA 1 1.010 - - QHG52325
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - otm25375
orthoMCL 1 0.900 - - OOG6_105725
Panther 1 1.100 - - LDO PTHR13025
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10220
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.