DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Swip-1 and efhd-1

DIOPT Version :9

Sequence 1:NP_001286079.1 Gene:Swip-1 / 35158 FlyBaseID:FBgn0032731 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_496961.2 Gene:efhd-1 / 175073 WormBaseID:WBGene00012980 Length:687 Species:Caenorhabditis elegans


Alignment Length:204 Identity:89/204 - (43%)
Similarity:131/204 - (64%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDSVDSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQIKDYQKT 77
            :|:....::....|.:||...|:||.:|.|.:...:::.   |.:::|.:|.||||.||:.:...
 Worm   488 EDTKPVETAPAPVDEAELNDALDRRNKINEGENVPLKMN---KKISLYAEFSEFSRKQIQYFSGI 549

  Fly    78 FNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGEL 142
            |..||..:|.::|..|||.||||||..|||:.||::|.:||||.|||||.|||.||||.|.:|||
 Worm   550 FKKYDEDQDSYIDFNELKRMMEKLGEAQTHIALKELIKKVDEDQDGKISQREFFLIFRLAASGEL 614

  Fly   143 DSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQ 207
            ........||.  .|||.:.||.||.|||:||||:|.:.::|.:|::.|:||::|:|||:..||:
 Worm   615 SCSEVFKTLAE--SVDVSKEGVLGAANFFQAKIEEQTKLSRFEEEMKEEKEEKKRQEEEKRARRE 677

  Fly   208 QFQQRAAIF 216
            :|....:||
 Worm   678 KFLASKSIF 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Swip-1NP_001286079.1 EFh 73..131 CDD:238008 31/57 (54%)
efhd-1NP_496961.2 EFh 545..602 CDD:238008 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I6153
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32580
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 1 1.000 - - FOG0003787
OrthoInspector 1 1.000 - - oto17773
orthoMCL 1 0.900 - - OOG6_105725
Panther 1 1.100 - - LDO PTHR13025
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10220
SonicParanoid 1 1.000 - - X2644
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.950

Return to query results.
Submit another query.