DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10431 and THAP3

DIOPT Version :10

Sequence 1:NP_609924.2 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_001381425.1 Gene:THAP3 / 90326 HGNCID:20855 Length:246 Species:Homo sapiens


Alignment Length:125 Identity:41/125 - (32%)
Similarity:66/125 - (52%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAHCAVINCSHKY-VHAGSISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGDEDF 64
            ||..||...|.::| .....::||||||.|.:||::|.....| ..:.|.:.:.:||.||..|.|
Human     1 MPKSCAARQCCNRYSSRRKQLTFHRFPFSRPELLKEWVLNIGR-GNFKPKQHTVICSEHFRPECF 64

  Fly    65 NCSNNRKTLKKNAVPSIRVSEDDSMSGHLEQVSPSNRPTHKQTLSSAAESAATGVKATCR 124
            :...|||.||.||||::...:|.:     :||..:..|..::..:|:::...|   :.||
Human    65 SAFGNRKNLKHNAVPTVFAFQDPT-----QQVRENTDPASERGNASSSQKEKT---SPCR 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10431NP_609924.2 THAP 5..81 CDD:461662 31/76 (41%)
zf-AD 123..192 CDD:214871 2/2 (100%)
SFP1 <665..727 CDD:227516
zf-C2H2_6 674..697 CDD:433576
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 705..726 CDD:275368
THAP3NP_001381425.1 THAP 5..82 CDD:461662 31/77 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.