DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10431 and ZFX

DIOPT Version :9

Sequence 1:NP_001286078.1 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_001317256.1 Gene:ZFX / 7543 HGNCID:12869 Length:844 Species:Homo sapiens


Alignment Length:377 Identity:75/377 - (19%)
Similarity:132/377 - (35%) Gaps:95/377 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 VVESSAAFRLHNCTLCTAKFITIDSLNQHYAHSHSNSTPMVSVPPMNICLPSLTMNPPMKMESNR 462
            |.:...|.::|.|..|..:......||:|....||.:.|       :||           :|..:
Human   548 VHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSKNFP-------HIC-----------VECGK 594

  Fly   463 GLVATEQSEYWPLEWHNSPVSKQPRKKIDILDMQSSFLHHKDLIPTATQLSAPAPDPQLVAVTAS 527
            |.            .|.|.:.|..|........|..:..::         ||.:.:.: ..|...
Human   595 GF------------RHPSELKKHMRIHTGEKPYQCQYCEYR---------SADSSNLK-THVKTK 637

  Fly   528 YAKLANRYRKLQLKC----------KKLKSPRKVHR--KTYVCRMCRKGFSKFKNLHHHRRQKAH 580
            ::|      ::..||          |:::....:|:  ||:.|..|....|...:|      |.|
Human   638 HSK------EMPFKCDICLLTFSDTKEVQQHALIHQESKTHQCLHCDHKSSNSSDL------KRH 690

  Fly   581 FVKL-IPNFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAFAHWRLYR 644
            .:.: ..::..:|..|.|.|.....|::|         :..|:..:..:||||. ...|...:..
Human   691 IISVHTKDYPHKCDMCDKGFHRPSELKKH---------VAAHKGKKMHQCRHCD-FKIADPFVLS 745

  Fly   645 RHELNCRPKKSKTKVQTAMNSKKKVTPTQVFECNICKKSFGSLNGLRQHNITHSTERQHKCGICE 709
            ||.|:...|...                  |.|..|:|.|...:.|::|..|||..:.::|..||
Human   746 RHILSVHTKDLP------------------FRCKRCRKGFRQQSELKKHMKTHSGRKVYQCEYCE 792

  Fly   710 RVFKRRNGLSQHIKGYHLQLKPHECPVCQHRYALKCDMLRCRHSLRKGPAAG 761
            ......:|..:|:...|.:..||.|..|:..:....:  :.:|.:|.....|
Human   793 YSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSE--KNQHIMRHHKEVG 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 10/25 (40%)
C2H2 Zn finger 677..697 CDD:275368 6/19 (32%)
C2H2 Zn finger 705..726 CDD:275368 5/20 (25%)
ZFXNP_001317256.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.