Sequence 1: | NP_001286078.1 | Gene: | CG10431 / 35157 | FlyBaseID: | FBgn0032730 | Length: | 762 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001381922.1 | Gene: | Thap2 / 688019 | RGDID: | 1593643 | Length: | 217 | Species: | Rattus norvegicus |
Alignment Length: | 231 | Identity: | 59/231 - (25%) |
---|---|---|---|
Similarity: | 83/231 - (35%) | Gaps: | 85/231 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPAHCAVINCSHKYVHAGSISFHRFPF--KRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGDED 63
Fly 64 FNCSNNRKTLKKNAVPSI------------------RVSEDDSMSG------------------- 91
Fly 92 ------------HLEQVSPSNRPTHKQTLSSAAESAATGVKATCRFCGSSAINCSSFDKSFELFG 144
Fly 145 MIQK-----CFPT---------LQILQDD----TLP 162 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10431 | NP_001286078.1 | THAP | 4..81 | CDD:283206 | 28/78 (36%) |
zf-AD | 123..192 | CDD:214871 | 17/58 (29%) | ||
zf-C2H2_6 | 674..700 | CDD:290623 | |||
C2H2 Zn finger | 677..697 | CDD:275368 | |||
C2H2 Zn finger | 705..726 | CDD:275368 | |||
Thap2 | NP_001381922.1 | THAP | 6..80 | CDD:398893 | 27/77 (35%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 65 | 1.000 | Domainoid score | I9778 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001174 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |