DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10431 and si:dkey-228b2.6

DIOPT Version :9

Sequence 1:NP_001286078.1 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_001373166.1 Gene:si:dkey-228b2.6 / 563918 ZFINID:ZDB-GENE-141216-225 Length:183 Species:Danio rerio


Alignment Length:176 Identity:40/176 - (22%)
Similarity:78/176 - (44%) Gaps:32/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGDEDFNCSNNRKTLKKNAVPSIRVS 84
            :||::||. :::..:.|.....|...|.||:.|:|||.||..:.|...:.|  |..:|.|::   
Zfish    13 VSFYKFPL-QEERRRIWSVNMGRDVGWTPSETSSLCSAHFTPDCFESGSAR--LHPDASPTL--- 71

  Fly    85 EDDSMSGHLEQVSPSNRPTHKQTLSSAAESAATGVKATCRFCGSSAINCS----SFDKSFELFGM 145
                    .....|.|:......:.|:.:.|:|..|.:.|   |:..:|:    :.::|::|   
Zfish    72 --------FNFTQPKNQIVKDTEIVSSHQGASTEPKDSSR---STCCDCNKRLHATERSYQL--- 122

  Fly   146 IQKCFPTLQILQDDTLPKEICQECCLQLERFSQFIDVVMLAQSELQ 191
             :.....|||       ||..:....:..:.:|:...|::.||.::
Zfish   123 -KLASANLQI-------KEYKKNLAEESRKAAQWQKRVIVLQSAIR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206 20/60 (33%)
zf-AD 123..192 CDD:214871 14/73 (19%)
zf-C2H2_6 674..700 CDD:290623
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 705..726 CDD:275368
si:dkey-228b2.6NP_001373166.1 THAP 6..72 CDD:214951 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001174
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.