DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10431 and CG1647

DIOPT Version :9

Sequence 1:NP_001286078.1 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:364 Identity:77/364 - (21%)
Similarity:122/364 - (33%) Gaps:121/364 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 CTLCTAKFITIDSLNQHY-----AHSHSNSTPMVSVPPMNICLPSLTMNPPMKMESNRGLVATEQ 469
            |:.|      :|.:|..|     .::.:..|..         |..|....|.::...:.:|..|:
  Fly    72 CSQC------VDKINDFYEFREMCYATNKQTRN---------LLGLKQIEPARLIDLKRIVKEER 121

  Fly   470 ---------------SEYWPLEWHNSPVSKQPRKKIDILDMQSSFLHHKDLIPTATQLSAPAPDP 519
                           .|.||   .|:.|..|.:|:        ||:.||      .|...|:...
  Fly   122 PISGAVGKRGRKRKGEESWP---KNNNVKPQVKKE--------SFVWHK------KQKLQPSQIT 169

  Fly   520 QLVAVTASYAKLANRYRKLQLKCKKLKSPRKVHRKTYVCRMCRKGFSKFKNLHHHRRQKAHFVKL 584
            .||:......|.....:...||    ..|:|..||: :|.:|.:.|.. |.|....:...| |..
  Fly   170 SLVSKREPEIKDEPAEQDTSLK----GPPKKAGRKS-ICSVCGEKFLS-KELADEHKSLVH-VPS 227

  Fly   585 IPNFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHRRLQS-FKCRHCQ---AIAFAHWRLYRR 645
            ||.:.  |:.|.:...::..:|.|..:         |:..:: :||..|:   |.|:|..|..|.
  Fly   228 IPRYI--CNACNQTHHNQSDIRAHQLW---------HKLSKTPYKCPLCESSVANAYAFTRHLRE 281

  Fly   646 HELNCRPKKSKTKVQTAMNSKKKVTPTQVF----ECNICKKSFGSLNGLRQHNITHSTE----RQ 702
            |                    ...||.|:.    ||.:|||:|.:       |..::|.    |:
  Fly   282 H--------------------TPPTPVQLLVLDRECPLCKKTFVT-------NFFYNTHRCAIRK 319

  Fly   703 HKCGICERVFKRRNGLSQHIKGYHLQLKPHECPVCQHRY 741
            .|||.|.|.........:|            .|.|...|
  Fly   320 RKCGGCSRTLNTEAAYMRH------------APTCPKIY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 7/29 (24%)
C2H2 Zn finger 677..697 CDD:275368 6/19 (32%)
C2H2 Zn finger 705..726 CDD:275368 5/20 (25%)
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 6/41 (15%)
C2H2 Zn finger 203..224 CDD:275368 5/21 (24%)
C2H2 Zn finger 233..253 CDD:275368 4/28 (14%)
C2H2 Zn finger 262..282 CDD:275368 7/19 (37%)
C2H2 Zn finger 297..314 CDD:275368 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.