DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10431 and THAP8

DIOPT Version :10

Sequence 1:NP_609924.2 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:NP_689871.1 Gene:THAP8 / 199745 HGNCID:23191 Length:274 Species:Homo sapiens


Alignment Length:85 Identity:30/85 - (35%)
Similarity:41/85 - (48%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAHCAVINCSHKYVHAGS----ISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGD 61
            ||.:|...|||:.....|:    :||::||.|....||.|.:. .....|:||....|||.||..
Human     1 MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQH-MGCEHWVPSCHQHLCSEHFTP 64

  Fly    62 EDFNCSNNRKTLKKNAVPSI 81
            ..|......:.|:.:|||||
Human    65 SCFQWRWGVRYLRPDAVPSI 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10431NP_609924.2 THAP 5..81 CDD:461662 26/79 (33%)
zf-AD 123..192 CDD:214871
SFP1 <665..727 CDD:227516
zf-C2H2_6 674..697 CDD:433576
C2H2 Zn finger 677..697 CDD:275368
C2H2 Zn finger 705..726 CDD:275368
THAP8NP_689871.1 THAP 4..86 CDD:214951 28/82 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..121 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.