DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10431 and si:ch73-138e16.4

DIOPT Version :9

Sequence 1:NP_001286078.1 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster
Sequence 2:XP_009294107.1 Gene:si:ch73-138e16.4 / 108179101 ZFINID:ZDB-GENE-070705-203 Length:252 Species:Danio rerio


Alignment Length:216 Identity:54/216 - (25%)
Similarity:84/216 - (38%) Gaps:59/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 KC-------KKLKSPR------KVH--RKTYVCRMCRKGFSKFKNLHHHRR----QKAHFVKLIP 586
            ||       |.|:|.:      ::|  .|.|.|..|.|...:...|..|.|    :|.|      
Zfish    53 KCFTCTECGKSLRSKQSLQFHMRIHTGEKPYTCTECGKSVRQSSALKIHMRIHTGEKPH------ 111

  Fly   587 NFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAFAHWRLYRRHELNCR 651
                :|..|.|.|.....|:.|:|.         |.:.:.:.|..| ..:||.....|:|:    
Zfish   112 ----KCDQCGKTFLIHSHLQNHLRV---------HTKEKPYSCCEC-GKSFATQSSLRKHQ---- 158

  Fly   652 PKKSKTKVQTAMNSKKKVTPTQVFECNICKKSFGSLNGLRQHNITHSTERQHKCGICERVFKRRN 716
                  |:.|.:  |:.|       |..|.|:|.:...|::|...|:.|:.:||..|::.|:|..
Zfish   159 ------KIHTGV--KEHV-------CLECGKTFITAQALKKHQRIHTEEKPYKCSYCDKSFRRTG 208

  Fly   717 GLSQHIKGYHLQLKPHECPVC 737
            .|..| :..|...||:.|..|
Zfish   209 DLKVH-ERIHTGEKPYTCDQC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 7/25 (28%)
C2H2 Zn finger 677..697 CDD:275368 6/19 (32%)
C2H2 Zn finger 705..726 CDD:275368 6/20 (30%)
si:ch73-138e16.4XP_009294107.1 C2H2 Zn finger 57..77 CDD:275368 3/19 (16%)
zf-H2C2_2 69..91 CDD:290200 5/21 (24%)
COG5048 <81..241 CDD:227381 48/188 (26%)
C2H2 Zn finger 85..105 CDD:275368 6/19 (32%)
zf-H2C2_2 97..120 CDD:290200 8/32 (25%)
C2H2 Zn finger 113..133 CDD:275368 7/28 (25%)
zf-H2C2_2 125..150 CDD:290200 7/34 (21%)
C2H2 Zn finger 141..161 CDD:275368 7/30 (23%)
C2H2 Zn finger 169..189 CDD:275368 6/19 (32%)
zf-H2C2_2 181..206 CDD:290200 8/24 (33%)
C2H2 Zn finger 197..217 CDD:275368 6/20 (30%)
zf-H2C2_2 209..234 CDD:290200 7/21 (33%)
C2H2 Zn finger 225..245 CDD:275368 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.