Sequence 1: | NP_001286078.1 | Gene: | CG10431 / 35157 | FlyBaseID: | FBgn0032730 | Length: | 762 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009294107.1 | Gene: | si:ch73-138e16.4 / 108179101 | ZFINID: | ZDB-GENE-070705-203 | Length: | 252 | Species: | Danio rerio |
Alignment Length: | 216 | Identity: | 54/216 - (25%) |
---|---|---|---|
Similarity: | 84/216 - (38%) | Gaps: | 59/216 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 541 KC-------KKLKSPR------KVH--RKTYVCRMCRKGFSKFKNLHHHRR----QKAHFVKLIP 586
Fly 587 NFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHRRLQSFKCRHCQAIAFAHWRLYRRHELNCR 651
Fly 652 PKKSKTKVQTAMNSKKKVTPTQVFECNICKKSFGSLNGLRQHNITHSTERQHKCGICERVFKRRN 716
Fly 717 GLSQHIKGYHLQLKPHECPVC 737 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10431 | NP_001286078.1 | THAP | 4..81 | CDD:283206 | |
zf-AD | 123..192 | CDD:214871 | |||
zf-C2H2_6 | 674..700 | CDD:290623 | 7/25 (28%) | ||
C2H2 Zn finger | 677..697 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 705..726 | CDD:275368 | 6/20 (30%) | ||
si:ch73-138e16.4 | XP_009294107.1 | C2H2 Zn finger | 57..77 | CDD:275368 | 3/19 (16%) |
zf-H2C2_2 | 69..91 | CDD:290200 | 5/21 (24%) | ||
COG5048 | <81..241 | CDD:227381 | 48/188 (26%) | ||
C2H2 Zn finger | 85..105 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 97..120 | CDD:290200 | 8/32 (25%) | ||
C2H2 Zn finger | 113..133 | CDD:275368 | 7/28 (25%) | ||
zf-H2C2_2 | 125..150 | CDD:290200 | 7/34 (21%) | ||
C2H2 Zn finger | 141..161 | CDD:275368 | 7/30 (23%) | ||
C2H2 Zn finger | 169..189 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 181..206 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 197..217 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 209..234 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 225..245 | CDD:275368 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24406 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |