DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tango6 and BTN2

DIOPT Version :9

Sequence 1:NP_609922.2 Gene:Tango6 / 35155 FlyBaseID:FBgn0032728 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_011658.3 Gene:BTN2 / 853043 SGDID:S000003374 Length:410 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:30/139 - (21%)
Similarity:57/139 - (41%) Gaps:26/139 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ESLRFSKALANTANNSGTAEALEINLRILEKYAKLEIGQ-QLHELCLEYQLTDDH-------ESS 68
            |.||:  |||.|.|....:.:..|...:..||...::|: :.:.....|.:..|.       |..
Yeast    60 EPLRY--ALAETPNGYTLSLSKRIPYELFSKYVNEKLGELKENHYRPTYHVVQDFFGNQYYVEDE 122

  Fly    69 IDPDSDRTICYIIRLQHVLHSIMRNINFHSDAK---EDLISVAHLKLCIQASQELSYYSLRCQLH 130
            .|.|:            :|.|.:::::|.:..|   :||.....::| .....|||..|.:.::.
Yeast   123 ADEDA------------LLRSALKDLDFRAIGKKIAKDLFQDYEIEL-NHRGDELSILSKKDKIF 174

  Fly   131 EDFYKSPIF 139
            ::|....:|
Yeast   175 KEFSLDQVF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tango6NP_609922.2 RTP1_C1 650..750 CDD:287349
BTN2NP_011658.3 PTZ00121 <262..402 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S988
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.