DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nak and PK3

DIOPT Version :9

Sequence 1:NP_477165.1 Gene:Nak / 35154 FlyBaseID:FBgn0015772 Length:1488 Species:Drosophila melanogaster
Sequence 2:NP_196433.1 Gene:PK3 / 830712 AraportID:AT5G08160 Length:347 Species:Arabidopsis thaliana


Alignment Length:304 Identity:91/304 - (29%)
Similarity:145/304 - (47%) Gaps:54/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LAEGGFAMVFLAR---------GNGGGSSSATK----------YALKRMYVNNEHDLNVAKREIQ 97
            |.|||||.|||.:         .:|||.:...|          ||:|::.:.|:..|.:.:.||:
plant    34 LGEGGFAFVFLVKEIVADASSAASGGGLAKKVKDPAHLSADGTYAMKKVLIQNKEQLELVREEIR 98

  Fly    98 IASNLSGHKNIIGYVDSSITPTGNG-----VCEVLLLMPYCKHHM-------LAMMNARLHVGFT 150
            : |:|..|.|::..:|.:|....:|     ..|..||.|.   |:       ..:|.|:... |:
plant    99 V-SSLFNHPNLLPLLDHAIISVKDGQEGAWKHEAFLLFPV---HLDGTLLDNFTLMKAKKET-FS 158

  Fly   151 EPEVLNIFCDIAEAVSRLHYCQTPIIHRDLKVENILQTDAGN----FVLCDFGSA--TAKTLNPQ 209
            ..:||:||..:.:.:..:|..:.|..|.|:|..|:|.|....    .:|.|||||  :.|.:..:
plant   159 TTDVLHIFRQLCDGLKHMHSLEPPYAHNDVKPGNVLLTRRKGQPPLAILMDFGSARPSRKQIRSR 223

  Fly   210 QHGVTVVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFSLPF----GES-- 268
            |..:. :||...::.:..:||||:.|......|..:.|||:|||.||.:.:...||    |||  
plant   224 QEALQ-LQEWTSEHCSAPFRAPELWDCPSHADIDERTDIWSLGCTLYAIMYGVSPFEYALGESGG 287

  Fly   269 --TLAIQNGQFSIPDS---SKYSKGMHQLIKYMLEPDMEKRPNI 307
              .|||.|.|...|::   :.|.:.:||.:.:||:|....||.|
plant   288 SLQLAIVNAQIKWPNTGPKASYPEALHQFVTWMLQPQAAVRPRI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NakNP_477165.1 STKc_NAK_like 42..319 CDD:270939 91/304 (30%)
S_TKc 47..312 CDD:214567 91/304 (30%)
PK3NP_196433.1 STKc_16 27..343 CDD:270888 91/304 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D831026at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.