DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nak and CG1227

DIOPT Version :9

Sequence 1:NP_477165.1 Gene:Nak / 35154 FlyBaseID:FBgn0015772 Length:1488 Species:Drosophila melanogaster
Sequence 2:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster


Alignment Length:300 Identity:96/300 - (32%)
Similarity:161/300 - (53%) Gaps:28/300 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKVFTVGRVTV-------TVEDVLAEGGFAMVFLARGNGGGSSSATKYALKRMYVNNEHDLNVAK 93
            |.:|:..:.|:       |:.:.||.|||:::.|    |..:|:...||:||:..::..|.|:|.
  Fly    13 GCLFSCRKETLNINGSRYTIRERLATGGFSLIDL----GENASTRRSYAIKRITCHSIDDQNIAL 73

  Fly    94 REIQIASNLSGHKNIIGYVDSSITPTG----NGVCEVLLLMPYCKHHMLA---MMNARLHVGFTE 151
            |||:....:.. :|:|..||..:....    |....:.:::||.||..||   .:.:|......|
  Fly    74 REIENCRKIDS-ENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPE 137

  Fly   152 PEVLNIFCDIAEAVSRLHYCQ-TPIIHRDLKVENILQTDAGNFVLCDFGSATAKTLN-PQQHGVT 214
            .::|.||..:.|.:..:|... .|:.|||||..||..:|:...::.|.||.|...|. ..|....
  Fly   138 AQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQ 202

  Fly   215 VVQEEIQKYTTLSYRAPEMIDLYGGKSITTKADIWALGCMLYKLCFFSLPF------GES-TLAI 272
            .:|:|.::.:::.|||||:..:....:|..:.|||:|||:||.:|:|:.|:      |:| .||:
  Fly   203 RLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAV 267

  Fly   273 QNGQFSIPDSSKYSKGMHQLIKYMLEPDMEKRPNIWQVCE 312
            .:|..:||:.|.|::.||:||||||..|..:||.::.|.|
  Fly   268 LSGNINIPEDSIYTEDMHELIKYMLRTDPMERPFVFSVIE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NakNP_477165.1 STKc_NAK_like 42..319 CDD:270939 93/293 (32%)
S_TKc 47..312 CDD:214567 92/280 (33%)
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 92/283 (33%)
S_TKc 30..300 CDD:214567 89/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D831026at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22967
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.