DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and YMR321C

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_014054.3 Gene:YMR321C / 855371 SGDID:S000004940 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:34/104 - (32%)
Similarity:53/104 - (50%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 KAENRLLGIGLNCV----NPLFVTPLLSSLTKVAGSDRIPLVVYSNRGEIYDVEQGDWTGTGEEV 291
            |....|..:|:|||    :|..:..|..:|..:|      |:.|.|.||:||.|:..|....:::
Yeast     7 KINPNLSFLGINCVSFNQSPDILESLHQALPNMA------LLAYPNSGEVYDTEKKIWLPNSDKL 65

  Fly   292 VKF---VPEWIQLGVRIVGGCCRVYPTDV----LAIRKY 323
            ..:   |.::|..|.||:|||||..|.|:    .|::||
Yeast    66 NSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 32/101 (32%)
YMR321CNP_014054.3 S-methyl_trans <10..105 CDD:419878 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345613
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002464
OrthoInspector 1 1.000 - - mtm9206
orthoMCL 1 0.900 - - OOG6_102920
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2187
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.