DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and Mtr

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_110491.2 Gene:Mtr / 81522 RGDID:621283 Length:1253 Species:Rattus norvegicus


Alignment Length:347 Identity:84/347 - (24%)
Similarity:143/347 - (41%) Gaps:57/347 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPILVKCGGFSS--QLAKNVTEKVDGD-------PLWGSR--FDATNPEAVIQTHLDFLRNGADI 65
            |.|:|..||..:  |..|...|...|.       ||.|:.  ...|.|:.:.|.|.::|..||||
  Rat    15 KRIMVLDGGMGTMIQRYKLSEENFQGQEFKDHSRPLKGNNDILSITQPDVIYQIHKEYLLAGADI 79

  Fly    66 ILTNTYQSSVEGFVKYLGVTRERGVE-----LIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGS 125
            |.|||:.|:......|       |:|     :.:.|..:|::|.|:...:.|.:.     .:.||
  Rat    80 IETNTFSSTSIAQADY-------GLEHLAYRMNKCSADVARKAAEEITLQTGVKR-----FVAGS 132

  Fly   126 IGPYGAYLHDGSEYTGNYADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAE----AVT 186
            :||....|.............::.:||...::.:.:..|..|||.|.:||:.....|:    |:.
  Rat   133 LGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQ 197

  Fly   187 ELVLDNFPDAK-FWVSLQCMDEKHMA----SGENFAEAALSLWRLVQSRKAENRLLGIGLNC-VN 245
            :|..:|:...: .::|...:|:....    :||.|..:.           :.:..|.||||| :.
  Rat   198 KLFEENYASPRPIFISGTIVDKSGRTLSGQTGEAFVTSV-----------SHSDPLCIGLNCALG 251

  Fly   246 PLFVTPLLSSLTKVAGSDRIPLVVYSNRGEIYDVEQGDWTGTGEEVVKFVPEWIQLG-VRIVGGC 309
            ...:.|.:.::.|...:   .::.|.|.|  .....||:..|...:...:.::...| |.:||||
  Rat   252 AAEMRPFIETIGKCTTA---YVLCYPNAG--LPNTFGDYDETPAMMAMHLKDFAVDGLVNVVGGC 311

  Fly   310 CRVYPTDVLAIRKYVDGLNIKP 331
            |...|..:..|.:.|.  |.||
  Rat   312 CGSTPDHIREIAEAVK--NCKP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 80/336 (24%)
MtrNP_110491.2 metH 1..1249 CDD:236539 84/347 (24%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q99707 370..372
Methylcob(III)alamin binding. /evidence=ECO:0000250|UniProtKB:P13009 770..774
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 1215..1216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11284
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44974
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.