DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and Bhmt

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_110477.1 Gene:Bhmt / 81508 RGDID:621496 Length:407 Species:Rattus norvegicus


Alignment Length:325 Identity:77/325 - (23%)
Similarity:131/325 - (40%) Gaps:54/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSSVEGF 78
            :::..|||...|.|.  ..|...| |.......:||||.|.|.:|||.|::::.|.|:.:|.:..
  Rat    22 VVIGDGGFVFALEKR--GYVKAGP-WTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKL 83

  Fly    79 VKYLGVTRERGVELIQK-SVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEYTGN 142
                   ..||..:.:| |.|...:|......::..|.::   |:.|.:....:||...||    
  Rat    84 -------ENRGNYVAEKISGQKVNEAACDIARQVADEGDA---LVAGGVSQTPSYLSCKSE---- 134

  Fly   143 YADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAE-AVTELVLDNFPDAKFWVSLQCMD 206
                  .|..:.:|: ::|:.:...||.|..|....:.||. ||..|.....|.|    :..|:.
  Rat   135 ------TEVKKIFHQ-QLEVFMKKNVDFLIAEYFEHVEEAVWAVEALKTSGKPIA----ATMCIG 188

  Fly   207 EKHMASGENFAEAALSLWRLVQSRKAENRLLGIGLNC-VNPLFVTPLLSSLTKVAGSDRIPLVVY 270
            .:....|.:..|.|:   |||::..|.     :|:|| .:|......:..:.:...:.|:...:.
  Rat   189 PEGDLHGVSPGECAV---RLVKAGAAI-----VGVNCHFDPSTSLQTIKLMKEGLEAARLKAYLM 245

  Fly   271 SNRGEIYDVEQGDW---------------TGTGEEVVKFVPEWIQLGVRIVGGCCRVYPTDVLAI 320
            |:....:..:.|..               ..|..::.|:..|...||||.:||||...|..:.||
  Rat   246 SHALAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPYHIRAI 310

  Fly   321  320
              Rat   311  310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 77/325 (24%)
BhmtNP_110477.1 S-methyl_trans 23..314 CDD:280696 77/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5383
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.