DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and Bhmt2

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_075022.2 Gene:Bhmt2 / 64918 MGIID:1891379 Length:363 Species:Mus musculus


Alignment Length:356 Identity:76/356 - (21%)
Similarity:115/356 - (32%) Gaps:117/356 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DTKPILVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSS 74
            |:..::|...||...|.|....|..   ||.......:|.||.|.|.:|||.|||::.|.|:.::
Mouse    18 DSGEVVVGDSGFLFTLEKRGFVKAG---LWTPEAVVEHPSAVRQLHTEFLRAGADVLQTFTFSAT 79

  Fly    75 VEGFVKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEY 139
            .:..............:|.|:..                             |..||.:..|...
Mouse    80 EDNMASKWEAVNAAACDLAQEVA-----------------------------GGGGALVAGGICQ 115

  Fly   140 TGNYADKMSKEELRAWH--KTRIEICLAAGVDGLALETLPCLMEAEAVTELVL------------ 190
            |..|  |..|:|.|..:  :.::|:.....||.|..|....:.||....|::.            
Mouse   116 TSLY--KYHKDETRIKNIFRLQLEVFARKNVDFLIAEYFEHVEEAVWAVEVLREVGAPVAVTMCI 178

  Fly   191 -------DNFP-----------------DAKF--WVSLQCMDEKHMASGENFAEAALSLWRLVQS 229
                   |..|                 :.:|  |.|||.|  |.|..|  ..:|:|....:|| 
Mouse   179 GPEGDMHDVTPGECAVKLARAGADIIGVNCRFGPWTSLQTM--KLMKEG--LRDASLQAHLMVQ- 238

  Fly   230 RKAENRLLGIGLNCVNPLFVTPLLSSLTKVAGSDRIPLVVYSNRGEIYDVEQGDW-----TGTGE 289
                         |:.  |.||                  ...:|...|:.:..:     ..|..
Mouse   239 -------------CLG--FHTP------------------DCGKGGFVDLPEYPFGLEPRVATRW 270

  Fly   290 EVVKFVPEWIQLGVRIVGGCCRVYPTDVLAI 320
            ::.|:..|...||:|.:||||...|..:.||
Mouse   271 DIQKYAREAYNLGIRYIGGCCGFEPYHIRAI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 76/356 (21%)
Bhmt2NP_075022.2 S-methyl_trans 23..305 CDD:280696 75/351 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.