DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and bhmt

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001011217.1 Gene:bhmt / 496651 XenbaseID:XB-GENE-1008382 Length:403 Species:Xenopus tropicalis


Alignment Length:329 Identity:79/329 - (24%)
Similarity:134/329 - (40%) Gaps:54/329 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DTKPILVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSS 74
            |...:::..|||...|.|.  ..|...| |.......:||||.|.|.:|||.||:::.|.|:.:|
 Frog    15 DAGEVVIGDGGFVFALEKR--GYVKAGP-WTPEAAVEHPEAVRQLHREFLRAGANVMQTFTFYAS 76

  Fly    75 VEGFVKYLGVTRERGVELIQK-SVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSE 138
            .:..       ..||..:.:| |.|...:|......|:.:|.::   |:.|           |..
 Frog    77 DDKL-------ENRGNYVAKKISGQKVNEAACDIAREVANEGDA---LVAG-----------GVS 120

  Fly   139 YTGNYADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQ 203
            .|.:|....|:.|::...:.::::.:...||.|..|....:.||....|::.::   .|...:..
 Frog   121 QTPSYLSCKSEVEVKGIFRKQLDVFIKKNVDFLIAEYFEHVEEAVWAVEVLKES---GKPVAATL 182

  Fly   204 CMDEKHMASGENFAEAALSLWRLVQSRKAENRLLGIGLNC-VNPL--FVTPLLSSLTKVAGSDRI 265
            |:..:...:|....|.|:        |.|:.....:|:|| .:|:  ..|..|.....||...:.
 Frog   183 CIGPQGDLNGVTPGECAV--------RLAKAGASVVGVNCHFDPMTCIATVKLMKEGLVAAKVKA 239

  Fly   266 -----PLVVYS----NRGEIYDVEQGDWT-----GTGEEVVKFVPEWIQLGVRIVGGCCRVYPTD 316
                 ||..::    .:|.| |:.:..:.     .|..::.|:..|...||||.:||||...|..
 Frog   240 HLMTQPLAYHTPDCGKQGFI-DLPEFPFALEPRIVTRWDIHKYAREAYNLGVRYIGGCCGFEPYH 303

  Fly   317 VLAI 320
            ..||
 Frog   304 TRAI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 79/329 (24%)
bhmtNP_001011217.1 S-methyl_trans 20..311 CDD:280696 78/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.