DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and MTR

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_011542496.1 Gene:MTR / 4548 HGNCID:7468 Length:1321 Species:Homo sapiens


Alignment Length:342 Identity:79/342 - (23%)
Similarity:133/342 - (38%) Gaps:57/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WNWDTKPI-LVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNT 70
            |.|...|: :|.||......|.:..         |......:|.:....:.::|..|||||.|||
Human    98 WRWLAWPLAVVTCGEHVFSAAPSAQ---------GGDSTTCHPRSKTCRNPEYLLAGADIIETNT 153

  Fly    71 YQSSVEGFVKYLGVTRERGVE-----LIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYG 130
            :.|:......|       |:|     :...|..:|::|.|:...:.|.:.     .:.|::||..
Human   154 FSSTSIAQADY-------GLEHLAYRMNMCSAGVARKAAEEVTLQTGIKR-----FVAGALGPTN 206

  Fly   131 AYLHDGSEYTGNYADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPD 195
            ..|.............::.:||...::.:.:..|..|||.|.:||:.....|:|.. ..|.|..:
Human   207 KTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAAL-FALQNLFE 270

  Fly   196 AKF-----WVSLQCMDEKHMA----SGENFAEAALSLWRLVQSRKAENRLLGIGLNC-VNPLFVT 250
            .|:     ::|...:|:....    :||.|..:.           :....|.||||| :....:.
Human   271 EKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISV-----------SHGEPLCIGLNCALGAAEMR 324

  Fly   251 PLLSSLTKVAGSDRIPLVVYSNRGEIYDVEQGDWTGTGEEVVKFVPEWIQLG-VRIVGGCCRVYP 314
            |.:..:.|...:   .::.|.|.|  .....||:..|...:.|.:.::...| |.||||||...|
Human   325 PFIEIIGKCTTA---YVLCYPNAG--LPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTP 384

  Fly   315 TDVLAIRKYVDGLNIKP 331
            ..:..|.:.|.  |.||
Human   385 DHIREIAEAVK--NCKP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 74/329 (22%)
MTRXP_011542496.1 metH 140..1317 CDD:236539 70/291 (24%)
MetH1 140..396 CDD:223719 67/286 (23%)
MeTr 427..683 CDD:238381
methionine_synthase_B12_BD 727..953 CDD:239020
Met_synt_B12 1021..1302 CDD:281030
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11469
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8560
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2187
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.