DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and MGC75760

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_988891.1 Gene:MGC75760 / 394486 XenbaseID:XB-GENE-5936142 Length:307 Species:Xenopus tropicalis


Alignment Length:309 Identity:124/309 - (40%)
Similarity:184/309 - (59%) Gaps:20/309 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSSVEGF 78
            :.:..||.|::| :|....:.|||||.:|...|||:|:...|..||::||:::.|.|||:||:||
 Frog     5 VKILSGGLSTEL-ENSGFLLQGDPLWSARLLQTNPQAIKNVHTSFLKSGAEVLSTATYQASVKGF 68

  Fly    79 VKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEYTGNY 143
            .::||::.:...||....|:|||:|    .:||   .::...||.||||||||:|.|||||||||
 Frog    69 QEHLGLSIDEVAELFHVGVRLAKEA----AAEI---KDNRNILIAGSIGPYGAFLSDGSEYTGNY 126

  Fly   144 ADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQCMDEK 208
            ...||.|||:.||:.:::...:||::..||||:|...||||:.|| |..||:...|:|..|.|..
 Frog   127 LRNMSVEELKDWHRLQMQCLASAGIELFALETIPGQKEAEALLEL-LREFPNTNAWLSYSCRDMS 190

  Fly   209 HMASGENFAEAALSLWRLVQSRKAENRLLGIGLNCVNPLFVTPLLSSLTKVAGSDRIPLVVYSNR 273
            ..:.|:.|.:|       |.......:|:.:|:||..|.||:.||:|..|..|.| |..:||.|.
 Frog   191 STSYGDAFEKA-------VGIAHKSKQLVAVGMNCCPPTFVSSLLTSANKNRGLD-IGWIVYPNS 247

  Fly   274 GEIYDVEQGDWTGTGEE--VVKFVPEWIQLGVRIVGGCCRVYPTDVLAI 320
            |:|:|...| |.|.|.|  :.::..||:.||.:.:||||...|:.:..:
 Frog   248 GKIWDHNLG-WQGGGTEKTLSEYALEWVNLGAKWIGGCCTTTPSAIATL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 124/309 (40%)
MGC75760NP_988891.1 mmuM 5..301 CDD:181899 124/309 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 215 1.000 Domainoid score I2664
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 216 1.000 Inparanoid score I3514
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 1 1.000 - - FOG0002464
OrthoInspector 1 1.000 - - otm48032
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3176
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.