powered by:
Protein Alignment CG10623 and CG7560
DIOPT Version :9
Sequence 1: | NP_001286073.1 |
Gene: | CG10623 / 35153 |
FlyBaseID: | FBgn0032727 |
Length: | 331 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648462.1 |
Gene: | CG7560 / 39276 |
FlyBaseID: | FBgn0036157 |
Length: | 349 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 16/61 - (26%) |
Similarity: | 25/61 - (40%) |
Gaps: | 4/61 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 FSSQLAKNVTEKVDGD-PLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSSVEGFVK 80
|.|...:.:...:|.| .:||..|...|....:|..|..|| |:.|....:...:|:.|
Fly 292 FVSLTVRTIRNVLDADVGVWGFHFFTLNRFKSVQAVLQELR---DLDLLKDSEKDKKGYEK 349
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45462324 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.