DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and CG7560

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_648462.1 Gene:CG7560 / 39276 FlyBaseID:FBgn0036157 Length:349 Species:Drosophila melanogaster


Alignment Length:61 Identity:16/61 - (26%)
Similarity:25/61 - (40%) Gaps:4/61 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FSSQLAKNVTEKVDGD-PLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSSVEGFVK 80
            |.|...:.:...:|.| .:||..|...|....:|..|..||   |:.|....:...:|:.|
  Fly   292 FVSLTVRTIRNVLDADVGVWGFHFFTLNRFKSVQAVLQELR---DLDLLKDSEKDKKGYEK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 16/61 (26%)
CG7560NP_648462.1 MTHFR 76..331 CDD:238299 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.