DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and Bhmt2

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001014278.2 Gene:Bhmt2 / 365972 RGDID:1359418 Length:363 Species:Rattus norvegicus


Alignment Length:330 Identity:80/330 - (24%)
Similarity:123/330 - (37%) Gaps:65/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DTKPILVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSS 74
            |:..::|..|||...|.|....|..   ||........|.||.|.|.:|||.|||::.|.|:.::
  Rat    18 DSGEVVVGDGGFLFTLEKRGFVKAG---LWTPEAVVEYPSAVRQLHTEFLRAGADVLQTFTFSAA 79

  Fly    75 VEGFVKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEY 139
            .:..............:|.|:                  .|:....|:.|.|.....|       
  Rat    80 EDRMESKWEAVNAAACDLAQE------------------VADGGAALVAGGICQTSLY------- 119

  Fly   140 TGNYADKMSKEELRAWHKTRIEICLAA--GVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSL 202
                  |..|:|.|..:..|:::.:.|  .||.|..|....:.||....|::.:  ..|...|::
  Rat   120 ------KYHKDETRIKNIFRLQLGVFARKNVDFLIAEYFEHVEEAVWAVEVLRE--VGAPVAVTM 176

  Fly   203 QCMDEKHMASGENFAEAALSLWRLVQSRKAENRLLGIGLNC-VNP---LFVTPLLSSLTKVAGSD 263
             |:..:....|....|.|:.|     ||...|.   ||:|| ..|   |....|:....:.||. 
  Rat   177 -CIGPEGDMHGVTPGECAVRL-----SRAGANI---IGVNCRFGPWTSLQTMKLMKEGLRDAGL- 231

  Fly   264 RIPLVVY--------SNRGEIYDVEQGDW-----TGTGEEVVKFVPEWIQLGVRIVGGCCRVYPT 315
            :..|:|.        ..:|...|:.:..:     ..|..::.|:..|...||||.:||||...|.
  Rat   232 QAHLMVQCLGFHTPDCGKGGFVDLPEYPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCCGFEPY 296

  Fly   316 DVLAI 320
            .:.||
  Rat   297 HIRAI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 80/330 (24%)
Bhmt2NP_001014278.2 S-methyl_trans 23..303 CDD:396912 79/325 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5383
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.