DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and Urod

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_610501.1 Gene:Urod / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster


Alignment Length:334 Identity:70/334 - (20%)
Similarity:109/334 - (32%) Gaps:114/334 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DTKPILVKCGGFSSQLAKNVTEKVDGDPLWGSR--------FD-----------ATNPEAVIQTH 55
            |.||..|.......:.|:.  |.||..|:|..|        |.           ...||...:..
  Fly     3 DAKPFPVLKNDNLLRAARG--EVVDRVPVWVMRQAGRYLPEFQELRKHHDFFTVCRTPELACEVT 65

  Fly    56 LDFLRN---GADIILTNTYQSSVEGFVKYLGVTRER----GVELIQKSV------QLAKQAKEQY 107
            :..||.   .|.||.     |.:....:.||:|.|.    |..|.|..|      :|........
  Fly    66 MQPLRRFDLDASIIF-----SDILVIPQALGLTVEMHAGVGPVLPQPIVVPEDLKRLTPDGALSR 125

  Fly   108 LSEIGS-------EAESALPLIMGSIGPY---GAYLHDGSEYTGNYADKMSKEELRAW------- 155
            ||.:|.       :.|..:|||..:..|:   |..:..|...|      |||  .:||       
  Fly   126 LSYVGDAITMMRHKLEGRVPLIGFTGAPWTLMGYMIEGGGSKT------MSK--AKAWLNEHPED 182

  Fly   156 HKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQCMDEKHMASGENFAEAA 220
            .|..:.:...|.||.|.       |:.:|..::             ||..:    :|.|:.::..
  Fly   183 SKLFLNLLTDAIVDYLE-------MQVKAGAQM-------------LQVFE----SSAEHLSKEQ 223

  Fly   221 LSLWRLVQSRKAENRLLGIGLNCVNPLFVTPLLSSLTKVAGSDRIPLVVYS--------NRGEI- 276
            ...|.:...::..:.                |:..|||.| ...:|:.:::        .:.|: 
  Fly   224 FLQWCVPYLKRIRDE----------------LVDRLTKKA-IPVVPMTLFAKGAGHSLKEQSELG 271

  Fly   277 YDVEQGDWT 285
            |||...|||
  Fly   272 YDVIGLDWT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 70/334 (21%)
UrodNP_610501.1 hemE 14..354 CDD:273640 66/323 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.