DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and bhmt

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001012498.1 Gene:bhmt / 322228 ZFINID:ZDB-GENE-030131-947 Length:400 Species:Danio rerio


Alignment Length:332 Identity:80/332 - (24%)
Similarity:132/332 - (39%) Gaps:70/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSS---V 75
            :::..|||...|.|.  ..|...| |.....|.:||||.|.|.:|||.|::::.|.|:.:|   :
Zfish    19 VVIGDGGFVFALEKR--GYVKAGP-WTPEAAAEHPEAVRQLHREFLRAGSNVMQTFTFYASDDKL 80

  Fly    76 EGFVKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEYT 140
            |.....|..|   |.::.:.:..||:        |:.:|.::   |:.|           |...|
Zfish    81 ENRGNKLSFT---GQQINEAACDLAR--------EVANEGDA---LVAG-----------GVSQT 120

  Fly   141 GNYADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAE-AVTELVLDNFPDAKFWVSLQC 204
            .:|....|:||::...|.::::.:...||.|..|....:.||| ||..|.....|.|    :..|
Zfish   121 PSYLSCKSEEEVKKTFKKQLDVFIKKNVDLLIAEYFEHVEEAEWAVQVLKATGKPVA----ATLC 181

  Fly   205 MDEKHMASGENFAEAALSLWRLVQSRKAENRLLGIG-----LNCVNPLFVTPLLSSLTKVAGSDR 264
            :.......|....|.|:   |||   ||...::|:.     |.||..:.   ::.:..:.||.. 
Zfish   182 IGPDGDMPGVTPGECAV---RLV---KAGADIVGVNCHFDPLTCVKTVV---MMKAAVEKAGLK- 236

  Fly   265 IPLVVYSNRGEIYDVEQGDWTG----------------TGEEVVKFVPEWIQLGVRIVGGCCRVY 313
               ..|..:...|........|                |..|:.::..|..:.|:|.:||||...
Zfish   237 ---AHYMTQPLAYHTPDCSCQGFIDLPEFPFALEPRILTRWEMQQYAREAYKAGIRYIGGCCGFE 298

  Fly   314 PTDVLAI 320
            |..:.|:
Zfish   299 PYHIRAV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 80/332 (24%)
bhmtNP_001012498.1 S-methyl_trans 20..309 CDD:280696 80/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.