DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10623 and BHMT2

DIOPT Version :9

Sequence 1:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_060084.2 Gene:BHMT2 / 23743 HGNCID:1048 Length:363 Species:Homo sapiens


Alignment Length:339 Identity:70/339 - (20%)
Similarity:122/339 - (35%) Gaps:91/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILVKCGGFSSQLAKNVTEKVDGDPLWGSRFDATNPEAVIQTHLDFLRNGADIILTNTYQSSVEGF 78
            :::..|.|...|.|....|..   ||.......:|:||.|.|::|||.|::::.|.|:.:|.:..
Human    22 VVIGDGSFLITLEKRGYVKAG---LWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSASEDNM 83

  Fly    79 VKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEYTGNY 143
                   ..:..::...:..||:        |:..:.::   |:.|.|.....|           
Human    84 -------ESKWEDVNAAACDLAR--------EVAGKGDA---LVAGGICQTSIY----------- 119

  Fly   144 ADKMSKEE--LRAWHKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQCM- 205
              |..|:|  ::...:.::|:.....||.|..|....:.||....|::.::  |....|:: |: 
Human   120 --KYQKDEARIKKLFRQQLEVFAWKNVDFLIAEYFEHVEEAVWAVEVLKES--DRPVAVTM-CIG 179

  Fly   206 ---DEKHMASGE---NFAEAALSLWRLVQSRKAENRLLGIGLNC-VNP----------------- 246
               |...:..||   ...:|..|:               :|:|| ..|                 
Human   180 PEGDMHDITPGECAVRLVKAGASI---------------VGVNCRFGPDTSLKTMELMKEGLEWA 229

  Fly   247 -----LFVTPLLSSLTKVAGSDRIPLVVYSNRGEIYDVEQGDWTGTGEEVVKFVPEWIQLGVRIV 306
                 |.|.||............:.|..|.     :.:|..  ..|..::.|:..|...||||.:
Human   230 GLKAHLMVQPLGFHAPDCGKEGFVDLPEYP-----FGLESR--VATRWDIQKYAREAYNLGVRYI 287

  Fly   307 GGCCRVYPTDVLAI 320
            ||||...|..:.||
Human   288 GGCCGFEPYHIRAI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 70/339 (21%)
BHMT2NP_060084.2 S-methyl_trans 23..303 CDD:308273 70/338 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5453
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.