DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and YMR321C

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_014054.3 Gene:YMR321C / 855371 SGDID:S000004940 Length:105 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:33/106 - (31%)
Similarity:50/106 - (47%) Gaps:31/106 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 IGVNCV----HPKFVTPLFKSLNGDREVGEQIPLVVYPNSGEVYDV-----------VNGWQGRE 283
            :|:|||    .|..:..|.::|       ..:.|:.|||||||||.           :|.|.   
Yeast    15 LGINCVSFNQSPDILESLHQAL-------PNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWD--- 69

  Fly   284 HCVPLANYVPEWAQLGAKVIGGCCRTYARDIRHIGEAIRDW 324
                  ..|.::...||::|||||||..:||:.|..|::.:
Yeast    70 ------TVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 33/103 (32%)
YMR321CNP_014054.3 S-methyl_trans <10..105 CDD:419878 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002464
OrthoInspector 1 1.000 - - mtm9206
orthoMCL 1 0.900 - - OOG6_102920
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2187
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.