DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and HMT-1

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_189219.1 Gene:HMT-1 / 822186 AraportID:AT3G25900 Length:326 Species:Arabidopsis thaliana


Alignment Length:332 Identity:118/332 - (35%)
Similarity:182/332 - (54%) Gaps:46/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGYME 72
            |.||||.||:.:| |.::: ||||||.....||..|...|:::|:.||||::|::||:::.|::.
plant    22 VVDGGFATQLEIH-GAAIN-DPLWSAVSLIKNPELIKRVHMEYLEAGADIVVTSSYQATIPGFLS 84

  Fly    73 Y-LELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGY----PLIIASIGPFGAHLHDGS 132
            . |.::|.:|  |::.:|.||..|::|     :..::|...|:    .|:.||||.:||:|.|||
plant    85 RGLSIEESES--LLQKSVELAVEARDR-----FWEKVSKVSGHSYNRALVAASIGSYGAYLADGS 142

  Fly   133 EYTGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAF 197
            ||:|.|.:.|...::.|:||.|::..:|||.|.||.||||.::||:|.||:|.::...:..|:.|
plant   143 EYSGHYGENVSLDKLKDFHRRRLQVLVEAGPDLLAFETIPNKLEAQACVELLEEEKVQIPAWICF 207

  Fly   198 QCKDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNCVHPKFVTPL---FKSLNGDREVGE 259
            ...|......||:|.:.       |...|..:...|:|:||..|:|:..|   |..|.       
plant   208 TSVDGEKAPSGESFEEC-------LEPLNKSNNIYAVGINCAPPQFIENLIRKFAKLT------- 258

  Fly   260 QIPLVVYPNSGEVYDVVNGWQGR------EHCV---PLANYVPEWAQLGAKVIGGCCRTYARDIR 315
            :..:|||||||||      |.|:      ..|.   ....:..:|..||||:|||||||....|.
plant   259 KKAIVVYPNSGEV------WDGKAKQWLPSQCFGDDEFEMFATKWRDLGAKLIGGCCRTTPSTIN 317

  Fly   316 HIGEAIR 322
            .|...::
plant   318 AISRDLK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 118/332 (36%)
HMT-1NP_189219.1 PLN02489 1..326 CDD:215269 118/332 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 195 1.000 Domainoid score I909
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101205
Inparanoid 1 1.050 198 1.000 Inparanoid score I1324
OMA 1 1.010 - - QHG62632
OrthoDB 1 1.010 - - D731388at2759
OrthoFinder 1 1.000 - - FOG0002464
OrthoInspector 1 1.000 - - mtm1099
orthoMCL 1 0.900 - - OOG6_102920
Panther 1 1.100 - - O PTHR46015
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3176
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.