DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and Bhmt

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_110477.1 Gene:Bhmt / 81508 RGDID:621496 Length:407 Species:Rattus norvegicus


Alignment Length:338 Identity:75/338 - (22%)
Similarity:110/338 - (32%) Gaps:67/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGY 70
            |::.||||  ...:.....|...| |:......:|.|:...|.:||:.|::::.|.|:.:|    
  Rat    22 VVIGDGGF--VFALEKRGYVKAGP-WTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYAS---- 79

  Fly    71 MEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIASIGPFGAHLHDGSEYT 135
                    |..:|...|.|......::.....|..|:....||..|:..           |...|
  Rat    80 --------EDKLENRGNYVAEKISGQKVNEAACDIARQVADEGDALVAG-----------GVSQT 125

  Fly   136 GSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAFQCK 200
            .||.......|:......::|..::..||.|..|......||...||.|......:   .|..|.
  Rat   126 PSYLSCKSETEVKKIFHQQLEVFMKKNVDFLIAEYFEHVEEAVWAVEALKTSGKPI---AATMCI 187

  Fly   201 DENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNC-VHPKFVTPLFKSLNGDREV------- 257
            ......||.:..:.        |.|..:.....:|||| ..|.......|.:....|.       
  Rat   188 GPEGDLHGVSPGEC--------AVRLVKAGAAIVGVNCHFDPSTSLQTIKLMKEGLEAARLKAYL 244

  Fly   258 ------------GEQ--IPLVVYPNSGEVYDVVNGWQGREHCVPLANYVPEWAQLGAKVIGGCCR 308
                        |:|  |.|..:| .|....|...|.       :..|..|...||.:.|||||.
  Rat   245 MSHALAYHTPDCGKQGFIDLPEFP-FGLEPRVATRWD-------IQKYAREAYNLGVRYIGGCCG 301

  Fly   309 TYARDIRHIGEAI 321
            .....||.|.|.:
  Rat   302 FEPYHIRAIAEEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 75/338 (22%)
BhmtNP_110477.1 S-methyl_trans 23..314 CDD:280696 74/335 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5383
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.