DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and BHMT

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001704.2 Gene:BHMT / 635 HGNCID:1047 Length:406 Species:Homo sapiens


Alignment Length:338 Identity:77/338 - (22%)
Similarity:115/338 - (34%) Gaps:67/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGY 70
            :::.||||  ...:.....|...| |:......:|.|:...|.:||:.|::::.|.|:.:|.|  
Human    22 IVIGDGGF--VFALEKRGYVKAGP-WTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYASED-- 81

  Fly    71 MEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIASIGPFGAHLHDGSEYT 135
                :|:...:..|.|.:      .:|.....|..|:....||..|:..           |...|
Human    82 ----KLENRGNYVLEKIS------GQEVNEAACDIARQVADEGDALVAG-----------GVSQT 125

  Fly   136 GSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAFQCK 200
            .||.......|:......::|..::..||.|..|......||...||.|......|   .|..|.
Human   126 PSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPV---AATMCI 187

  Fly   201 DENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNC-----VHPKFVTPLFKSLNGDR----- 255
            ......||....:.        |.|..:.....|||||     :..|.|..:.:.|...|     
Human   188 GPEGDLHGVPPGEC--------AVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHL 244

  Fly   256 ----------EVGEQ--IPLVVYPNSGEVYDVVNGWQGREHCVPLANYVPEWAQLGAKVIGGCCR 308
                      :..:|  |.|..:| .|....|...|.       :..|..|...||.:.|||||.
Human   245 MSQPLAYHTPDCNKQGFIDLPEFP-FGLEPRVATRWD-------IQKYAREAYNLGVRYIGGCCG 301

  Fly   309 TYARDIRHIGEAI 321
            .....||.|.|.:
Human   302 FEPYHIRAIAEEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 77/338 (23%)
BHMTNP_001704.2 S-methyl_trans 23..312 CDD:308273 76/333 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5453
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8560
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.