DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and MGC75760

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_988891.1 Gene:MGC75760 / 394486 XenbaseID:XB-GENE-5936142 Length:307 Species:Xenopus tropicalis


Alignment Length:318 Identity:126/318 - (39%)
Similarity:190/318 - (59%) Gaps:23/318 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGY 70
            |.:..||..|::. :.|..:.||||||||...|||.||.:.|..||::||:::.|.|||:||.|:
 Frog     5 VKILSGGLSTELE-NSGFLLQGDPLWSARLLQTNPQAIKNVHTSFLKSGAEVLSTATYQASVKGF 68

  Fly    71 MEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIA-SIGPFGAHLHDGSEY 134
            .|:|.|..::..||....||||.           :|...:::...::|| ||||:||.|.|||||
 Frog    69 QEHLGLSIDEVAELFHVGVRLAK-----------EAAAEIKDNRNILIAGSIGPYGAFLSDGSEY 122

  Fly   135 TGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAFQC 199
            ||:|...:..:|:.||||::::....||::..|:||||.|.|||||:|:| .::|:...|:::.|
 Frog   123 TGNYLRNMSVEELKDWHRLQMQCLASAGIELFALETIPGQKEAEALLELL-REFPNTNAWLSYSC 186

  Fly   200 KDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNCVHPKFVTPLFKSLNGDREVGEQIPLV 264
            :|.::.::|:.|..|..     :|.::.|  .:|:|:||..|.||:.|..|.|.:|  |..|..:
 Frog   187 RDMSSTSYGDAFEKAVG-----IAHKSKQ--LVAVGMNCCPPTFVSSLLTSANKNR--GLDIGWI 242

  Fly   265 VYPNSGEVYDVVNGWQGREHCVPLANYVPEWAQLGAKVIGGCCRTYARDIRHIGEAIR 322
            ||||||:::|...||||......|:.|..||..||||.|||||.|....|..:.:.:|
 Frog   243 VYPNSGKIWDHNLGWQGGGTEKTLSEYALEWVNLGAKWIGGCCTTTPSAIATLLQTLR 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 126/318 (40%)
MGC75760NP_988891.1 mmuM 5..301 CDD:181899 126/318 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 215 1.000 Domainoid score I2664
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H101205
Inparanoid 1 1.050 216 1.000 Inparanoid score I3514
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 1 1.000 - - FOG0002464
OrthoInspector 1 1.000 - - otm48032
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3176
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.