DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and bhmt

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001012498.1 Gene:bhmt / 322228 ZFINID:ZDB-GENE-030131-947 Length:400 Species:Danio rerio


Alignment Length:404 Identity:80/404 - (19%)
Similarity:126/404 - (31%) Gaps:146/404 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGY 70
            |::.||||  ...:.....|...| |:....|.:|.|:...|.:||:.|::::.|.|:.:|.|  
Zfish    19 VVIGDGGF--VFALEKRGYVKAGP-WTPEAAAEHPEAVRQLHREFLRAGSNVMQTFTFYASDD-- 78

  Fly    71 MEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIASIGPFGAHLHDGSEYT 135
                        :|.....:|:...::.....|..|:....||..|:..           |...|
Zfish    79 ------------KLENRGNKLSFTGQQINEAACDLAREVANEGDALVAG-----------GVSQT 120

  Fly   136 GSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEM-----------LC---- 185
            .||......:|:....:.:::..::..||.|..|......|||..|::           ||    
Zfish   121 PSYLSCKSEEEVKKTFKKQLDVFIKKNVDLLIAEYFEHVEEAEWAVQVLKATGKPVAATLCIGPD 185

  Fly   186 DDYPDVKFWVAFQCKDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNC------------ 238
            .|.|.|              ..||.......|..|:            :||||            
Zfish   186 GDMPGV--------------TPGECAVRLVKAGADI------------VGVNCHFDPLTCVKTVV 224

  Fly   239 ----------VHPKFVT-PLFK-----SLNGDREVGEQIPLVVYPNSGEVYDVVNGWQGREHCVP 287
                      :...::| ||..     |..|..::.| .|..:.|.      ::..|:       
Zfish   225 MMKAAVEKAGLKAHYMTQPLAYHTPDCSCQGFIDLPE-FPFALEPR------ILTRWE------- 275

  Fly   288 LANYVPEWAQLGAKVIGGCCRTYARDIRHIGE--------------------------------- 319
            :..|..|..:.|.:.|||||......||.:.|                                 
Zfish   276 MQQYAREAYKAGIRYIGGCCGFEPYHIRAVAEELSAERGFLPEASQKHGLWGSGLEMHTKPWVRA 340

  Fly   320 -AIRD-WNKLKKLS 331
             |.|| |.|||..|
Zfish   341 RARRDYWEKLKPAS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 73/393 (19%)
bhmtNP_001012498.1 S-methyl_trans 20..309 CDD:280696 71/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.