DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and BHMT2

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_060084.2 Gene:BHMT2 / 23743 HGNCID:1048 Length:363 Species:Homo sapiens


Alignment Length:346 Identity:79/346 - (22%)
Similarity:120/346 - (34%) Gaps:92/346 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGY 70
            |::.||.|  .:|:.....|... ||:......:|.|:...|::||:.|::::.|.|:.:|    
Human    22 VVIGDGSF--LITLEKRGYVKAG-LWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSAS---- 79

  Fly    71 MEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIASIGPFGAHLHDGSEYT 135
                    |.::|.....|..|         .|..|:....:|..|:...|.....:.:...|  
Human    80 --------EDNMESKWEDVNAA---------ACDLAREVAGKGDALVAGGICQTSIYKYQKDE-- 125

  Fly   136 GSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCD-DYPDVKFWVAF-Q 198
                     ..|....|.::|......||.|..|......||...||:|.: |.|     ||. .
Human   126 ---------ARIKKLFRQQLEVFAWKNVDFLIAEYFEHVEEAVWAVEVLKESDRP-----VAVTM 176

  Fly   199 C----KDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNCVHPKF-------VTPLFKSLN 252
            |    .|.:.:..||            .|.|..:.....:||||   :|       ...|.|  .
Human   177 CIGPEGDMHDITPGE------------CAVRLVKAGASIVGVNC---RFGPDTSLKTMELMK--E 224

  Fly   253 GDREVGEQIPLVVYPNSGEVYDVVNGWQGREHCVPLANY-------------VPEWAQ----LGA 300
            |....|.:..|:|.|......|.     |:|..|.|..|             :.::|:    ||.
Human   225 GLEWAGLKAHLMVQPLGFHAPDC-----GKEGFVDLPEYPFGLESRVATRWDIQKYAREAYNLGV 284

  Fly   301 KVIGGCCRTYARDIRHIGEAI 321
            :.|||||......||.|.|.:
Human   285 RYIGGCCGFEPYHIRAIAEEL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 79/346 (23%)
BHMT2NP_060084.2 S-methyl_trans 23..303 CDD:308273 77/341 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I5453
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.