DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and T13G4.4

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001370579.1 Gene:T13G4.4 / 188484 WormBaseID:WBGene00020491 Length:304 Species:Caenorhabditis elegans


Alignment Length:335 Identity:81/335 - (24%)
Similarity:126/335 - (37%) Gaps:84/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTRVLVKDGGFGTQMTVHVG---DSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQ 64
            :.|:|  ||...:|: :..|   :..:..|.||...|| :...:.:.:..||.....:|.:|||.
 Worm     1 MVRLL--DGSMSSQL-LRFGYDCNQQENKPHWSFPANA-DMELMENVYKSFLDLEVKVITSNTYH 61

  Fly    65 --SSVDG-----------YMEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPL 116
              |::|.           |.:|.|          :..::|.|:.......|.:            
 Worm    62 FGSTLDKTIPENAEKRELYEKYFE----------ETCLKLCHLTTGSSDVEAW------------ 104

  Fly   117 IIASIGPFGAHLHDGSEYTGSYADFVPAKE---------ITDWHRVRIEACLEAGVDALAIETIP 172
              .|:|......||.|||||:|.|...||:         :|.:|.       .:.:..|..||||
 Worm   105 --GSVGTLATMYHDLSEYTGAYMDQSEAKKTAYDYFKIILTLFHN-------RSSIRKLIFETIP 160

  Fly   173 CQMEAEALVEMLCDDYPDVKFWVAFQCKDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVN 237
            ...|....:::| .::|:.:..::|..|:...|.|||.....|.       :.....:.|.||:|
 Worm   161 SADEGSVALDVL-QEFPEFEAVISFTFKEHGCLRHGEKITSVAQ-------QMKQSPQVLGIGIN 217

  Fly   238 CVHPKFVTPLFKSLNGDREVGEQIP-----LVVYPNSGEVYDVVNGWQGREHCVPLANYVPEWAQ 297
            |..|..|.|....|.         |     :.||||.|:...:..|..  |..|.....|..|.:
 Worm   218 CTDPNNVLPALNELQ---------PFAFSEVFVYPNKGDSKFLEEGID--ESNVFTKTLVTSWIE 271

  Fly   298 LGAKVIGGCC 307
            .|...|||||
 Worm   272 KGVTAIGGCC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 81/333 (24%)
T13G4.4NP_001370579.1 S-methyl_trans 4..292 CDD:396912 80/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165234
Domainoid 1 1.000 85 1.000 Domainoid score I5217
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I3727
Isobase 1 0.950 - 0 Normalized mean entropy S12209
OMA 1 1.010 - - QHG62632
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 1 1.000 - - FOG0002464
OrthoInspector 1 1.000 - - otm14258
orthoMCL 1 0.900 - - OOG6_102920
Panther 1 1.100 - - LDO PTHR46015
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2187
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.