DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10621 and Bhmt

DIOPT Version :9

Sequence 1:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_057877.1 Gene:Bhmt / 12116 MGIID:1339972 Length:407 Species:Mus musculus


Alignment Length:338 Identity:79/338 - (23%)
Similarity:118/338 - (34%) Gaps:67/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVKDGGFGTQMTVHVGDSVDGDPLWSARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGY 70
            |::.||||  ...:.....|...| |:......:|.|:...|.:||:.|::::.|.|:.:|    
Mouse    22 VVIGDGGF--VFALEKRGYVKAGP-WTPEAAVEHPEAVRQLHREFLRAGSNVMQTFTFYAS---- 79

  Fly    71 MEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIASIGPFGAHLHDGSEYT 135
                    |..:|...|.|......::.....|..|:....||..|:...:....::|...||  
Mouse    80 --------EDKLENRGNYVAEKISGQKVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSE-- 134

  Fly   136 GSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAFQCK 200
                  |..|:|   .|.::|..::..||.|..|......||...||.|......|   .|..|.
Mouse   135 ------VEVKKI---FRQQLEVFMKKNVDFLIAEYFEHVEEAVWAVEALKASGKPV---AATMCI 187

  Fly   201 DENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNC-----VHPKFVTPLFKSLNGDR----- 255
            ......||....:.        |.|..:.....:||||     |..:.|..:.:.|...|     
Mouse   188 GPEGDLHGVPPGEC--------AVRLVKAGASIVGVNCHFDPSVSLQTVKLMKEGLEAARLKAYL 244

  Fly   256 ----------EVGEQ--IPLVVYPNSGEVYDVVNGWQGREHCVPLANYVPEWAQLGAKVIGGCCR 308
                      :.|:|  |.|..:| .|....|...|.       :..|..|...||.:.|||||.
Mouse   245 MSQPLAYHTPDCGKQGFIDLPEFP-FGLEPRVATRWD-------IQKYAREAYNLGVRYIGGCCG 301

  Fly   309 TYARDIRHIGEAI 321
            .....||.|.|.:
Mouse   302 FEPYHIRAIAEEL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 79/338 (23%)
BhmtNP_057877.1 S-methyl_trans 23..314 CDD:280696 78/335 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0646
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.