powered by:
Protein Alignment CG10428 and Prmt6
DIOPT Version :9
Sequence 1: | NP_609918.1 |
Gene: | CG10428 / 35150 |
FlyBaseID: | FBgn0032724 |
Length: | 585 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_849222.3 |
Gene: | Prmt6 / 99890 |
MGIID: | 2139971 |
Length: | 378 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 18/73 - (24%) |
Similarity: | 30/73 - (41%) |
Gaps: | 24/73 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 357 KSSALPK-ERLERKRQQL------------ENLANAVVS-----------LAQPGDRIVDFCSGT 397
:.:|.|: .|.:.:|.|| |.:|:.|.: .|..|..::|..:||
Mouse 32 QEAAPPRPRRTKSERDQLYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGT 96
Fly 398 GHLAILLA 405
|.|:|..|
Mouse 97 GILSIFCA 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.