DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and TMT1

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_011102.3 Gene:TMT1 / 856922 SGDID:S000000977 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:119 Identity:28/119 - (23%)
Similarity:46/119 - (38%) Gaps:37/119 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 PHFPLTSTWFSEIDSFGDKCARVLRD---------LYVPQAIKTPPGELGIPDCEATSLYKAD-- 302
            |.:|  |.::..||.:.|...::|.|         |.:.|.:| |..::...|..||.:..|:  
Yeast    19 PSYP--SDFYKMIDEYHDGERKLLVDVGCGPGTATLQMAQELK-PFEQIIGSDLSATMIKTAEVI 80

  Fly   303 ----PKRYKPRNRIYTSQLELEAALSKLSSLQLQFNSDSEHTYGQQLIDWEQIE 352
                |..||  |..:           |:||      ||.....|...:|.::|:
Yeast    81 KEGSPDTYK--NVSF-----------KISS------SDDFKFLGADSVDKQKID 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 3/8 (38%)
AdoMet_MTases 368..486 CDD:302624
TMT1NP_011102.3 AdoMet_MTases 33..>147 CDD:418430 23/103 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.