Sequence 1: | NP_609918.1 | Gene: | CG10428 / 35150 | FlyBaseID: | FBgn0032724 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013706.1 | Gene: | ERG6 / 855003 | SGDID: | S000004467 | Length: | 383 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 206 | Identity: | 39/206 - (18%) |
---|---|---|---|
Similarity: | 71/206 - (34%) | Gaps: | 64/206 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 307 KPRNRIYTSQLELEAALSK--LSSLQLQFNSDSEHTYGQQLIDWEQIEPTHAKSSALPKERLERK 369
Fly 370 RQQLENLANAV------------------------VSLA------------QPGDRIVDFCSGTG 398
Fly 399 HLAILLALKLPNCTIIVMENKAFSLLQAQKRSNELGLTNCVFYQCNIDYFVGGF----------- 452
Fly 453 ---KIGASLHA 460 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10428 | NP_609918.1 | GST_C_family | <212..258 | CDD:198286 | |
AdoMet_MTases | 368..486 | CDD:302624 | 24/143 (17%) | ||
ERG6 | NP_013706.1 | Cfa | 66..>277 | CDD:225139 | 24/142 (17%) |
Methyltransf_11 | 124..222 | CDD:400514 | 17/84 (20%) | ||
Sterol_MT_C | 306..368 | CDD:400686 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |