DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and ERG6

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_013706.1 Gene:ERG6 / 855003 SGDID:S000004467 Length:383 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:39/206 - (18%)
Similarity:71/206 - (34%) Gaps:64/206 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 KPRNRIYTSQLELEAALSK--LSSLQLQFNSDSEHTYGQQLIDWEQIEPTHAKSSALPKERLERK 369
            :.|...:|.:|..:....|  ||:|..:.||..:....:.|.:|:......|:     :.|||..
Yeast     7 RKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGRTDKDAE-----ERRLEDY 66

  Fly   370 RQQLENLANAV------------------------VSLA------------QPGDRIVDFCSGTG 398
            .:...:..|.|                        .|:|            |.||.::|...|.|
Yeast    67 NEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESFAASIARHEHYLAYKAGIQRGDLVLDVGCGVG 131

  Fly   399 HLAILLALKLPNCTIIVMENKAFSLLQAQKRSNELGLTNCVFYQCNIDYFVGGF----------- 452
            ..|..:| :...|.:|.:.|..:.:.:|:..:.:..|::      .:|:..|.|           
Yeast   132 GPAREIA-RFTGCNVIGLNNNDYQIAKAKYYAKKYNLSD------QMDFVKGDFMKMDFEENTFD 189

  Fly   453 ---KIGASLHA 460
               .|.|:.||
Yeast   190 KVYAIEATCHA 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 24/143 (17%)
ERG6NP_013706.1 Cfa 66..>277 CDD:225139 24/142 (17%)
Methyltransf_11 124..222 CDD:400514 17/84 (20%)
Sterol_MT_C 306..368 CDD:400686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.