DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Mettl7a1

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_081610.2 Gene:Mettl7a1 / 70152 MGIID:1916523 Length:244 Species:Mus musculus


Alignment Length:179 Identity:36/179 - (20%)
Similarity:64/179 - (35%) Gaps:54/179 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 LLALKLPNCTIIVMENKAFSLLQAQKRSNELGLTNCVFYQCNIDYFVGGFKI------------- 454
            :|||:|..||:.:   ..|.|       |.|||.:.|..:| ..||:..|.:             
Mouse     5 VLALRLVVCTLAL---PMFLL-------NLLGLWSWVCKKC-FPYFLKRFSVMYNEQMASQKREL 58

  Fly   455 --------GASLH------ACGTATDIVLQQCRRAKAHFVCCP--CCYGSLQPMPHISYPLSKAF 503
                    |.|..      .|||.            |:|...|  |....:.|.|:....|.|:.
Mouse    59 FSNLQEFAGPSGKLTLLEVGCGTG------------ANFKFYPPGCRVTCIDPNPNFEKFLFKSV 111

  Fly   504 QKVLDTKDYLYIAHSADQAHEMGTTNCKPETTLQGLHCMSVVDTDRLLQ 552
            .:....:...::..:.:..|::  |:...:..:..|...||.:.:::|:
Mouse   112 AENRQLQFERFVVAAGEDMHQV--TDGSVDVVVCTLVLCSVKNQEKILR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 26/111 (23%)
Mettl7a1NP_081610.2 SmtA 70..>187 CDD:223574 17/103 (17%)
Methyltransf_11 75..172 CDD:285453 17/98 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.