DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Ndufaf5

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_081369.2 Gene:Ndufaf5 / 69487 MGIID:1916737 Length:343 Species:Mus musculus


Alignment Length:238 Identity:49/238 - (20%)
Similarity:78/238 - (32%) Gaps:82/238 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 DWEQIEPTHAKSSALPKERLERKRQQLENLANAVVSLAQPGDRIVDFCSGTGHLAILL------- 404
            :|...:|...|...|.:|...|       :|:.|..:|:.....:|...|.|::|..|       
Mouse    57 NWAARQPDPMKFDYLKEEVGSR-------IADRVYDIARDFPLALDIGCGRGYIAQHLDKETVGK 114

  Fly   405 ---------ALK------LPNCTIIVMENKAFSLLQAQKRSNELGLTNCVFYQCN--------ID 446
                     |||      :|...|:..|    ..|..|:.:.:|.:::...:..|        |.
Mouse   115 IFQTDIAEHALKNSLETDIPTVNILADE----EFLPFQENTFDLVVSSLSLHWVNDLPRALEQIH 175

  Fly   447 Y-------FVGGFKIGASLH--ACGTATDIVLQQCRRAKAHFVCCPCCYGSLQPMPHIS------ 496
            |       |||....|.:|:  .|    .:.|.:..|.           |...  ||||      
Mouse   176 YVLKPDGVFVGAMFGGDTLYELRC----SLQLAETERE-----------GGFS--PHISPFTAVN 223

  Fly   497 ---YPLSKAFQKVL--DTKD----YLYIAHSADQAHEMGTTNC 530
               :.|.:|....|  ||.:    |..:....:....||.:||
Mouse   224 DLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMEDLKGMGESNC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286
AdoMet_MTases 368..486 CDD:302624 29/156 (19%)
Ndufaf5NP_081369.2 BioC 93..310 CDD:273953 40/195 (21%)
Methyltransf_11 94..185 CDD:285453 17/94 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.