DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10428 and Atpsckmt

DIOPT Version :9

Sequence 1:	NP_609918.1	Gene:	CG10428 / 35150	FlyBaseID:	FBgn0032724	Length:	585	Species:	Drosophila melanogaster
Sequence 2:	NP_080822.1	Gene:	Atpsckmt / 68073	MGIID:	1915323	Length:	247	Species:	Mus musculus

Alignment Length:	87	Identity:	21/87 - (24%)
Similarity:	31/87 - (35%)	Gaps:	23/87 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly   138 KFCEVDLVAVVSKLHSGQVLEFVPQEVVRFEQHMNEPVRMHNIYKQAREQANQTENGGKVKRRER 202
            ||...||..|....:|..|:..|||.:.:.|:.:.                .:.|:|.:|
Mouse   135 KFYISDLWKVTFAQYSNVVIFGVPQMMPQLEKKLE----------------LELEDGARV----- 178

  Fly   203 VQIKCTTPKEELLIEHRFAEGI 224
              |.|..|......:|...|||
Mouse   179 --IACRFPFPRWTPDHTTGEGI 198

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10428	NP_609918.1	GST_C_family	<212..258	CDD:198286	4/13 (31%)
CG10428	NP_609918.1	AdoMet_MTases	368..486	CDD:302624
Atpsckmt	NP_080822.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..25
		Required for mitochondrial location. /evidence=ECO:0000250\|UniProtKB:Q6P4H8	51..85
		BchM-ChlM	<87..>157	CDD:273930	7/21 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	209..247
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900