DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10428 and Alkbh8

DIOPT Version :9

Sequence 1:NP_609918.1 Gene:CG10428 / 35150 FlyBaseID:FBgn0032724 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006509942.1 Gene:Alkbh8 / 67667 MGIID:1914917 Length:709 Species:Mus musculus


Alignment Length:382 Identity:70/382 - (18%)
Similarity:128/382 - (33%) Gaps:131/382 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 KVKRRERVQIKCTTPKEELLIEHRFAEGISFTIADIIL----------YPLLRIVFQHCGQ---- 246
            |:.:.|:..::..:....:|::|...:.:|:....:::          ...|.:..:.||.    
Mouse    55 KLTKMEKKFLRKQSKARHVLLKHEGIQAVSYPTQSLVIANGGLGNGVSRKQLLLTLEKCGPVEAL 119

  Fly   247 -MLPHFPLTSTWFSE----------------IDSFGDKCARVLRDLYVPQA-------IKTPPGE 287
             |.|:.|.....|..                ||..|.|....|.  :|.:|       ...|||.
Mouse   120 LMPPNKPYAFVIFQTIEESKKAYFTLNGKEIIDDLGQKIFLYLN--FVEKAQWKNMGLEALPPGL 182

  Fly   288 LGIPDCEATSLYKADPKRYKPRNRIYTSQLELEAALSKLSSLQLQFNSDSEHTYGQQLIDWEQIE 352
            |.:.:                   |.:|:.|.:...|      :.:..|:.:...|:.:...:::
Mouse   183 LVVEE-------------------IISSEEEKKLLES------VNWTEDTGNQNFQRSLKHRRVK 222

  Fly   353 ----PTHAKSSALPKER----------------------LERKRQQLENLANAVVSLAQPG---- 387
                ..|.:|:.:.|::                      ::.|..||      .::..:||    
Mouse   223 HFGYEFHYESNTVDKDKPLPGGLPEVCSSILEKLLKEGYIKHKPDQL------TINQYEPGHGIP 281

  Fly   388 ----------DRIVDFCSGTGHLAILLALKLP-NCTIIVMENKAFSLLQAQKRSNEL---GLTNC 438
                      |.|:....|:   ||::..|.| ..|:.||..:. |||.....|..|   |:|..
Mouse   282 AHIDTHSAFEDEIISLSLGS---AIVMDFKHPEGVTVQVMLPRR-SLLVMTGESRYLWTHGITPR 342

  Fly   439 VF--YQCNIDYFVGGF---KIG-ASLHACGTATDIVLQQCRRAKAHFVCCPCCYGSL 489
            .|  .|.: :.|.||.   .|| .:|...|..|....::.||     :.|.|.|.|:
Mouse   343 KFDTVQAS-EQFKGGIITSDIGDLTLSKRGMRTSFTFRKVRR-----MPCNCSYSSV 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10428NP_609918.1 GST_C_family <212..258 CDD:198286 9/60 (15%)
AdoMet_MTases 368..486 CDD:302624 36/141 (26%)
Alkbh8XP_006509942.1 DUF1891 46..82 CDD:117570 4/26 (15%)
RRM_ALKBH8 87..167 CDD:240877 13/81 (16%)
2OG-FeII_Oxy 197..379 CDD:389772 38/198 (19%)
Methyltransf_25 455..542 CDD:379312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.